PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G009400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 386aa    MW: 42137 Da    PI: 8.1841
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G009400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-4191167278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C v+gC++dls++++yhrrhkvCe hsk+p+v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Manes.13G009400.1.p  91 CLVDGCTSDLSKCRDYHRRHKVCELHSKTPKVFIKGQEQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKPQP 167
                          **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-3483152IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12988165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.41E-3989170IPR004333Transcription factor, SBP-box
PfamPF031102.8E-3091164IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGCNLQTPWR LAELENQNIT YIARTTVSSC LEVHKVTGHC SVDLKLGNSG DLEDKLVEKF  60
AGPAEFLMES SSSGSSKRVR TPSNGNQVPS CLVDGCTSDL SKCRDYHRRH KVCELHSKTP  120
KVFIKGQEQR FCQQCSRFHS LVEFDEGKRS CRKRLDGHNR RRRKPQPDSL SVTSSRLFSN  180
HQGTRYLQFG GSQMFSTSPE SSAWNGAIKP ENDPMLYTSQ SSLNFGSRKN FFPGSLSHGY  240
RSGKQFPFLQ CTSSALPGES ICQTILHAGS TLGSSCSSQK MLSDGPNRVI DSNRALSLLS  300
SPSAENCEIR LSHMVQPESD LNPPAHSLIS SLNFSCLGME NGSVDSVLVS DGSSNANLHG  360
QSMFQIGPDG SSSSGSLQTL SFSWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29911641184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147164KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012085714.10.0PREDICTED: squamosa promoter-binding-like protein 16
SwissprotQ6YZE81e-64SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLB9RMC20.0B9RMC2_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s13630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-50SBP family protein